Full NameCalcitonin, salmon
AliasThyrocalcitonin
Sequence
(one letter code)
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2
Sequence{CYS}{SER}{ASN}{LEU}{SER}{THR}{CYS}{VAL}{LEU}{GLY}
{LYS}{LEU}{SER}{GLN}{GLU}{LEU}{HIS}{LYS}{LEU}{GLN}
{THR}{TYR}{PRO}{ARG}{THR}{ASN}{THR}{GLY}{SER}{GLY}
{THR}{PRO}-NH2
C-TerminalNH2
Chemical BridgeDisulfide bridge: Cys1-Cys7
StorageStore at -20°C.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC145H240N44O48S2
M.W.3431.85
Cas47931-85-1
DescriptionCalcitonin (salmon) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide; that peptide appears to function in the nervous and vascular systems. The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.
NotesCalcitonin is a 32 amino acid polypeptide, 8 of which are conserved across all species.
Purity> 95%

* For Non-Clinical Research Use Only *


STRUCTURE:
Calcitonin, salmon Structure
Zoom
HPLC:  20060721145620  (PDF)
MS:  20060721145600  (PDF)
Reference:
  • Schweitzer-Stenner R, et al. Salmon calcitonin and amyloid beta: two peptides with amyloidogenic capacity adopt different conformational manifolds in their unfolded states. Biochemistry. Mar 2006; 45(9): 2810-2819.
  • Sahin F, et al. Efficacy of salmon calcitonin in complex regional pain syndrome (type 1) in addition to physical therapy. Clin. Rheumatol. Mar 2006; 25(2): 143-148.
  • Ofluoglu D, et al. Early effect of nasal salmon calcitonin on the bone marker Crosslaps. Rheumatol. Int. Feb 2006; 26(4): 288-291.

Introduction:

    GenScript provides gene, peptide, protein, and antibody products and services to the international scientific community. GenScript specializes in custom gene and peptide synthesis, siRNA construction, and both polyclonal and monoclonal antibody production. Our state-of-the-art methodology incorporates meticulous design tools and a unified approach to synthesis that ensure our customers the highest quality results.
    The GenScript philosophy is to adjust the process to the customer's needs, regardless of whether that customer is a small or large business, a university, or other institution, whether we are to assist fellow molecular biologists or complement researchers in a related field. Our dedicated management, laboratory, and customer service team values our clients' interests from planning to delivery, all the while providing innovative, quality products and services at the most competitive prices in the industry.